What is the clamping mechanism of the terminal connection line?

Categories:Company News
Author:
Origin:
Time of issue:2020-07-20 11:19
Views:

(Summary description)Theprincipleandmethodofmarkingterminalconnectionlineswithalphanumericsymbols,andthetwoendpointsofasinglecomponentarerepresentedbytwoconsecutivenumbers.　　Themiddleterminalsofasinglecomponentarerepresentedbynumbersinnaturalincreasingsequence.Identicalcomponentgroupsareprefixedwithlettersbeforethenumbers,suchasthelettersU1,V1,W1,etc.thatmarkthethree-phaseACsystem.　　Ifthereisnoneedtodistinguishbetweenphases,thenumbers1.1,2.1,3.1canbeusedtosign.Groupsofsimilarcomponents.　　Theterminalconnectionlineisamarkoftheelectricalwiringterminalconnectedtoaspecificwire.Theclampingmechanismoftheterminalisamechanismthatgeneratespressurebetweenthewireandtheconductivestrip.Onlywhensufficientpressureisgeneratedcanalowcontactresistanceandagoodconnectionbeformed.Therefore,thereliabilityoftheclampingmechanismdirectlyaffectsthewireconnectionGoodorbad.　　Forscrew-typeterminals,screws,copperpostsandpressureplatesareimportantcomponentsofthecompressionmechanism;fornon-threadedterminals,springsorspringcardsareimportantcomponentsofthecompressionmechanism.Theterminalconnectionlinehasnothreadedterminal.Thepressingmechanismismainlyaspring,sotheselectionofthespringisveryimportant.Itisnecessarytoensurethatthereissufficientcontactpressureandtoensurethatthewireisnotexcessivelydamaged.ThespringterminaliscurrentlyrelativelyreliablewithoutthreadTerminal.Whenenteringthewire,youcanpressthespringwithapushblockorascrewdriver.Afterenteringthewire,loosenthespring,usethespring'sreturnforcetotightlypressthewiretogeneratesufficientcontactpressure,andthenusethebladeofthespringtochokethewire.Makeitnotlooseorpulledoutartificially.





What is the clamping mechanism of the terminal connection line?

Categories:Company News
Author:
Origin:
Time of issue:2020-07-20 11:19
Views:

Information

The principle and method of marking terminal connection lines with alphanumeric symbols, and the two end points of a single component are represented by two consecutive numbers.

　　The middle terminals of a single component are represented by numbers in natural increasing sequence. Identical component groups are prefixed with letters before the numbers, such as the letters U1, V1, W1, etc. that mark the three-phase AC system.

　　 If there is no need to distinguish between phases, the numbers 1.1, 2.1, 3.1 can be used to sign. Groups of similar components.

　　The terminal connection line is a mark of the electrical wiring terminal connected to a specific wire. The clamping mechanism of the terminal is a mechanism that generates pressure between the wire and the conductive strip. Only when sufficient pressure is generated can a low contact resistance and a good connection be formed. Therefore, the reliability of the clamping mechanism directly affects the wire connection Good or bad.

　　For screw-type terminals, screws, copper posts and pressure plates are important components of the compression mechanism; for non-threaded terminals, springs or spring cards are important components of the compression mechanism.

The terminal connection line has no threaded terminal. The pressing mechanism is mainly a spring, so the selection of the spring is very important. It is necessary to ensure that there is sufficient contact pressure and to ensure that the wire is not excessively damaged. The spring terminal is currently relatively reliable without thread Terminal.

When entering the wire, you can press the spring with a push block or a screwdriver. After entering the wire, loosen the spring, use the spring's return force to tightly press the wire to generate sufficient contact pressure, and then use the blade of the spring to choke the wire. Make it not loose or pulled out artificially.

Scan the QR code to read on your phone

Previous: Tell about the wire production characteristics of the digital cable

Next: What are the specific advantages of the terminal connection line?

Previous: Tell about the wire production characteristics of the digital cable

Next: What are the specific advantages of the terminal connection line?

Related News

2023-04-26

How can we identify the harness of UAV?

The selection of harness materials for UAV is closely related to the quality and service life of harness. Don't be greedy and cheap when choosing harness products for drones. If you are a UAV pilot or maintenance personnel, you must have enough technical ability to distinguish between qualified and unqualified UAV harnesses, otherwise it will lead to unnecessary losses. Cheap products may be made of inferior materials.

2023-04-24

How to ensure the processing quality of UAV harness? What factors affect its life?

How to ensure the processing quality of UAV harness? What factors affect its life? In the field of UAV harness processing, the quality of UAV harness products has become the core that all enterprises must grasp, which is related to the lifeline of the whole company. If you want to stand out from many enterprises, you will definitely not miss the important competitive factor of quality assurance. While ensuring the quality of UAV harness products, we should also improve the service quality and strive to achieve double optimization of production and service quality. The following UAV harness manufacturers will introduce you to the four elements of quality assurance of UAV harness processing.

2023-04-21

Do you know how to install the wiring harness of smart home appliances?

How can the wiring harness of smart home appliances be installed in the system? Let's take a look at it. Different types and models of wiring harness for smart home appliances have different installation forms. Generally speaking, when selecting electrical components, the same installation form should be